SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010176330.1.30499 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010176330.1.30499
Domain Number 1 Region: 7-161
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.31e-67
Family TRADD, N-terminal domain 0.00000477
Further Details:      
 
Domain Number 2 Region: 206-300
Classification Level Classification E-value
Superfamily DEATH domain 2.9e-16
Family DEATH domain, DD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010176330.1.30499
Sequence length 306
Comment PREDICTED: tumor necrosis factor receptor type 1-associated DEATH domain protein [Antrostomus carolinensis]; AA=GCF_000700745.1; RF=representative genome; TAX=279965; STAX=279965; NAME=Antrostomus carolinensis; AL=Scaffold; RT=Major
Sequence
MAGSSTPWIGSAYLFLQSTCKTLVLPSLYESSQKKPSVFKALKLALADSTGSMNGVDMLK
VHCSHPHLIVQLKFCKQENCRRFLQSYREGALQKSLQNHLQVSLAMTTVPLEMELKAGNE
HLDNILKDEDRCLECIYREKPDRLRDEEITELEECLKSLILHQSINNHMTVKDYPSVNFP
PLPNPSQGSSLSPQVTFIFQGQQFANRTLTPDDHQKFAKLVSKKWKQVGRSLQKNCRALR
DPVIDNLALEYDREGLYEQAYQLLLRFIQSEGKKATIARLIAALEENGLISLAEELLGLH
SNEDCS
Download sequence
Identical sequences XP_010176330.1.30499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]