SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010224637.1.20684 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010224637.1.20684
Domain Number 1 Region: 19-122
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 2.09e-37
Family Nucleoplasmin-like core domain 0.0000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010224637.1.20684
Sequence length 154
Comment PREDICTED: nucleoplasmin-3 [Tinamus guttatus]; AA=GCF_000705375.1; RF=representative genome; TAX=94827; STAX=94827; NAME=Tinamus guttatus; AL=Scaffold; RT=Major
Sequence
MSNVRRMAHVAVSSSASDLLLPGCELTSSTKSYTFKVDEEDDSDHILALSVVCLTDGAKD
ECNVVEVVGRNHENQEIAVPVANLRLSCQPLLSLDNFQLQPPVTFRLAAGSGPVHLAGWH
QIVHREDDSFEEEDDMSEDEIAPVMPAKKQRGKQ
Download sequence
Identical sequences XP_010224637.1.20684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]