SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010231682.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010231682.1.954
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000000000314
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.003
Further Details:      
 
Domain Number 2 Region: 84-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000291
Family Cold shock DNA-binding domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010231682.1.954
Sequence length 175
Comment PREDICTED: DNA-directed RNA polymerase V subunit 7 [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MVFLLADMSWNVLISPDQLSSKGLLLRKSILVRLLEDIANRKASKEHGYYIAVNELKEIS
EGKVRELTGDVLFPVTFTCITLKPMKGEILVGSVEKILKHGVFLKSGPIENVFLSEKTMN
DYKYIGGENPMFMKDHSKLEKDTVLRFKAMGFRWMEADRQFQLLATLAGDFLGPL
Download sequence
Identical sequences A0A0Q3K909
XP_003568883.1.954 XP_010231682.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]