SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010461915.1.75697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010461915.1.75697
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.000000000000327
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0021
Further Details:      
 
Domain Number 2 Region: 84-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000565
Family Cold shock DNA-binding domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010461915.1.75697
Sequence length 178
Comment PREDICTED: DNA-directed RNA polymerase V subunit 7-like isoform X1 [Camelina sativa]; AA=GCF_000633955.1; RF=representative genome; TAX=90675; STAX=90675; NAME=Camelina sativa; cultivar=DH55; AL=Chromosome; RT=Major
Sequence
MFLKVQLPWNVMIPAENMDAKGLILKRAILVQLLDAFASKKATKELGYYVAVTTLDKIGE
GKIREHTGEVLFPVMFSGMTFKIFKGEIIHGVVHKVLKHGVFMRCGPIENVYLSYTKMPD
YKYIPGENPIFMNDKMSRIQVEATVRVVVLGTKWMEAEREFQALASLEGDYLGPIFEE
Download sequence
Identical sequences XP_010461914.1.75697 XP_010461915.1.75697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]