SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010747175.2.61708 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010747175.2.61708
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.45e-34
Family Rap30/74 interaction domains 0.00001
Further Details:      
 
Domain Number 2 Region: 176-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.98e-23
Family DNA-binding domain from rap30 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010747175.2.61708
Sequence length 254
Comment PREDICTED: general transcription factor IIF subunit 2-like [Larimichthys crocea]; AA=GCF_000972845.1; RF=representative genome; TAX=215358; STAX=215358; NAME=Larimichthys crocea; AL=Scaffold; RT=Major
Sequence
MSEKTEVNLSGVKQSQGVWLVKVPKYLSQQWDKATEKGDVGKISIGKKQGKTEVRFSLNE
ELTVLGTVGEKDASLQVPKDHPFTMHTVGGQTMAVFSQSDTDEISLEGMVVHRAECRPVV
NDNYMKLKKLQIKESTKSPRLSQQLERAITTVFKPVANHDFNVVYDKKKKSEGKMVRAER
QVVLDMLFSAFEKHQYYNIKDLVDITKQPVTYLKEIMKEIGTYNNKGAHKSTWELKPEYR
HYQSAEEEEEMQTA
Download sequence
Identical sequences XP_010747175.2.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]