SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010811097.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010811097.1.76553
Domain Number 1 Region: 268-352
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-26
Family RING finger domain, C3HC4 0.0000114
Further Details:      
 
Domain Number 2 Region: 354-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000094
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010811097.1.76553
Sequence length 1043
Comment PREDICTED: V(D)J recombination-activating protein 1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAVSLPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKAPENAQAEKQDSSEGKPSLE
QSPAALDKVGGPKPALTQPVLKPHPKFQKKSHDDGKARDKAIHQANLRHLCRICGNSLKA
DQHHRRYPVHGPVDGKTQVLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCW
SFMHRKFSSAPREVYSSRNATMEWHPHTPSCDICDAARRGLKRKSQPPNSQLSKRLRTVI
DRARQARRCKRRTQDRISSKELMKKTTNCSKIHLSTRLLAVDFPAHFVKSISCQICEHIL
ADPVETNCKHVFCRICILRCLKVLGSYCPSCQYPCFPTDLESPVKSFLSILNSLMVKCPA
EECDEEVSLEKYNHHVSSHKESKETFVHINKGGRPRQHLLSLTRRAQKHRLRELKMQVKA
FADKEEGGDVKSVCLTLFLLALRARNEHRQADELEAIMKGRGSGLQPAVCLAIRVNTFLS
CSQYHKMYRTVKAITGRQIFQPLHSLRSAEKVLLPGYHPFEWQPPLKNVSSSTDVGIIDG
LSGLASSVDDYPVDTIAKRFRYDAALVSALMDMEEDILEGMRARELDDYLNGPFTVVVKE
SCDGMGDVSEKHGSGPAVPEKAVRFSFTVMKISVAHGSQNVKVFEEAKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKSSELMLEMGGILRTFKFIFRGTGYDEKLVREVEG
LEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHETVEELRDRVK
GVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHL
RKKMNLKPIMRMNGNFARKLMTKETVEAVCELIPSQERHEALKELMDLYLKMKPVWRSSC
PAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWA
SEGNESGNKLFRRFRKMNARQSKYYEMEDVLKHHWLYTSKYLQKFMNAHNALKDSGFTLN
SQGGLGDLLDLEESPESQDSMEF
Download sequence
Identical sequences F1MG60
XP_010811097.1.76553 XP_010821203.1.59421 ENSBTAP00000048319 ENSBTAP00000048319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]