SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010954756.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010954756.1.22495
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.09e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000589
Further Details:      
 
Domain Number 2 Region: 79-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.69e-22
Family Cold shock DNA-binding domain-like 0.00000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010954756.1.22495
Sequence length 172
Comment PREDICTED: DNA-directed RNA polymerase II subunit RPB7 [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDILTQQGDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
Download sequence
Identical sequences XP_010954756.1.22495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]