SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010960157.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010960157.1.22495
Domain Number 1 Region: 219-308
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 8.55e-27
Family tRNA-intron endonuclease catalytic domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010960157.1.22495
Sequence length 312
Comment PREDICTED: tRNA-splicing endonuclease subunit Sen34 isoform X1 [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLL
AEIGAVTLVSAPRPDPRQHSLALASFKRQQEQGFQEQSALAAEARETRRQELLEKIAEGQ
AAKKQKLEQESGTSGSQEPGGNQAAEENEASASQAAGEHEEAGEGSSSPQPGPSNGVAPL
PRSALLVQLATARPRPIKARPLDWRVQSKDWPHAGRPAHELRYSIYRDLWERGFFLSAAG
KFGGDFLVYPGDPLRFHAHYIAQCWAPGDPIPLQDLVSAGRLGTSVRKTLLLCSPQPDGK
VVYTSLQWASLQ
Download sequence
Identical sequences XP_010960156.1.22495 XP_010960157.1.22495 XP_010960158.1.22495 XP_010960159.1.22495 XP_010960160.1.22495 XP_010960161.1.22495 XP_010960162.1.22495 XP_010960163.1.22495 XP_010997600.1.51371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]