SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011026043.1.28252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011026043.1.28252
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 4.71e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0013
Further Details:      
 
Domain Number 2 Region: 79-186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000024
Family Cold shock DNA-binding domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011026043.1.28252
Sequence length 191
Comment PREDICTED: DNA-directed RNA polymerase III subunit RPC8-like isoform X2 [Populus euphratica]; AA=GCF_000495115.1; RF=representative genome; TAX=75702; STAX=75702; NAME=Populus euphratica; AL=Scaffold; RT=Major
Sequence
MFYLSLIEHKMLLPPRLLNLPLQDAIKEELQNIFLDKVISKLGLCISIYDIRKIDGGFIS
PGEGASTYTVEFRMIVFRPFVGEIISAKLKESTADGLRLSLGFFDDINIPAGLIQKPSHR
VPDPENRYKVLWVWEFNGEEFFVDGIDEIRFKVISVTYPPTPIEQQGEPFAPMVITGSID
GDGLGPVSWWQ
Download sequence
Identical sequences XP_011026042.1.28252 XP_011026043.1.28252 XP_011028729.1.28252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]