SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011091122.1.78198 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011091122.1.78198
Domain Number 1 Region: 84-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000398
Family Cold shock DNA-binding domain-like 0.0057
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000000000719
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011091122.1.78198
Sequence length 176
Comment DNA-directed RNA polymerase V subunit 7 [Sesamum indicum]; AA=GCF_000512975.1; RF=representative genome; TAX=4182; STAX=4182; NAME=Sesamum indicum; cultivar=Zhongzhi No. 13; AL=Chromosome; RT=Major
Sequence
MFLRSQLSWNVVIPAQNLDAEGLILQKAILIGLLDEFAAKKASKDIGYFLAVTTLDHIGK
GIIRQHSGDLLFPVDFSCITFKMFPGEILEGIVHKILKHGVFVKCGPAEKVYISHLKMAD
YQYVPGENPCFRNDKSTKIEKGTVVRFLVLAEKYDEAEKDFRAVVSLEGDFLGPIN
Download sequence
Identical sequences XP_011091118.1.78198 XP_011091119.1.78198 XP_011091120.1.78198 XP_011091121.1.78198 XP_011091122.1.78198 XP_011091123.1.78198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]