SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011144002.1.56509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011144002.1.56509
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.22e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0022
Further Details:      
 
Domain Number 2 Region: 79-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000591
Family Cold shock DNA-binding domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011144002.1.56509
Sequence length 200
Comment PREDICTED: DNA-directed RNA polymerase III subunit RPC8 [Harpegnathos saltator]; AA=GCF_000147195.1; RF=representative genome; TAX=610380; STAX=610380; NAME=Harpegnathos saltator; strain=R22 G/1; AL=Scaffold; RT=Major
Sequence
MFILADLKDTVRTTPNNFKQKLNDVITDELNRKLGNKVYVNVGLCIMLYDITKIEESHVF
PGDGASHTNVSFRFVVFRPFMEEILIGKTRFCSADGIHVTLGFFDDIIIPPHKLPYPSRF
DQRDQVWVWEYKTEEGSTHDLYVDLEELIRFRVVNEIFTEETPKPPDTVEKEETNKVAPY
ILHGSIDEAGLGPLLWWENA
Download sequence
Identical sequences E2BRQ7
Hsal_10745--XP_394665.1_APIME XP_011144002.1.56509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]