SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011182320.1.96551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011182320.1.96551
Domain Number 1 Region: 159-289
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.18e-44
Family Regulator of G-protein signaling, RGS 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011182320.1.96551
Sequence length 306
Comment PREDICTED: regulator of G-protein signaling 17 [Bactrocera cucurbitae]; AA=GCF_000806345.1; RF=representative genome; TAX=28588; STAX=28588; NAME=Zeugodacus cucurbitae; strain=USDA-PBARC White Pupae T1; AL=Scaffold; RT=Major
Sequence
MSCTVSELPSGCHLRGMSSSSSSAVAAVKSHSGGGGGSTLSTGGGGGSNSGGLNTGGIHV
GGMLSTTSALGVTTTSSRGGSTGNAAASLLPETLMTTTPMSSSTTQRQQQQQQSQKPCCF
CWCCCCSCSWAKCLAIKNAEDNAPTRRDPASVDLLLDGEQPCLEEIRSWGKSFDLLMKNS
TGRKVFRDFLRSEFSEENILFWLACEELKKESSSEAIEEKARLIYEDYISILSPREVSLD
SRVREIVNRNMVEPTPHTFDEAQIQIYTLMHRDSYPRFLNSQKFKALAQLQDGSLSAAAS
TTDSPT
Download sequence
Identical sequences A0A0A1WRB4
XP_011182320.1.96551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]