SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011614133.1.43653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011614133.1.43653
Domain Number 1 Region: 23-70
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 4.58e-18
Family Cysteine-rich DNA binding domain, (DM domain) 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011614133.1.43653
Sequence length 295
Comment PREDICTED: doublesex and mab-3 related transcription factor 1 isoform X1 [Takifugu rubripes]; AA=GCF_000180615.1; RF=representative genome; TAX=31033; STAX=31033; NAME=Takifugu rubripes; AL=Chromosome; RT=Major
Sequence
MTKEKQSKASAGTVTPSKGPKPPRMPKCSRCRNHGFVSPLKGHKRFCNWRDCQCLKCKLI
VERQRVMAAQVALRRQQAQEEELGICSPVPLSGAGMMVKNEAGAECFFSAEGRNQAATST
SSSSVVPASRSVTSSRPSAGARAANDGQSDLLLESSFYNLYQPSCYPAYYGNLYNYQQYQ
QMPHGDGRLQNHNVSPQYCVHSYCSGGPYLSQGLSSSTCVPPIFSVEDNNSNNNSCPQTL
ATTFSPSSPSTGPDSSMTCRPISTMVTSDLHPECEATGETANFTISSIMDGDAGN
Download sequence
Identical sequences XP_011614133.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]