SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011667964.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011667964.1.5271
Domain Number 1 Region: 230-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000336
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 23-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000275
Family Somatomedin B domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011667964.1.5271
Sequence length 275
Comment PREDICTED: adhesive plaque matrix protein isoform X13 [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
MDRHLLLFLAVIGLVSHQVSAQRGSCEDCCDCGYMVGVGCYCDSFCQRAGDCCSDYTTVC
ADDNSDYSYEFSWPSDYPSEYSYEFSWPSDYPSEYSHEFSWPSDYPSEYSYEFSWPSDYP
SEYSHEFSWPSDYPSEYSYEFSWPSDYPSEYSHEFSWPSDYPSEYSHEFSWPSDYPSEYS
HEFSWPSDYPSEYSYEFSWPSDYPSEYSHEFSWPSDYPSEYSYEFSWPSEIDVCLSSPCL
NGGLCQASGGSYFCFCPAAFYGVDCELGGDSGNSV
Download sequence
Identical sequences XP_011667964.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]