SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011669257.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011669257.1.5271
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 9.81e-25
Family eIF-2-alpha, C-terminal domain 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011669257.1.5271
Sequence length 97
Comment PREDICTED: eukaryotic translation initiation factor 2 subunit 1-like [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
MSSEEMPIKINLIAPPQYVVTTQTLERVEGVEKLKEAIEAIKESILKSAGVFKVMMAPKV
VTDTEEQELARHLENLEKANAEVDGDDDGEEIGNEED
Download sequence
Identical sequences W4Y0R9
XP_011669257.1.5271 SPU_009292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]