SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011681391.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011681391.1.5271
Domain Number 1 Region: 77-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 115-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 3-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011681391.1.5271
Sequence length 150
Comment PREDICTED: neurogenic locus notch homolog protein 3-like, partial [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
DLCYSMPCQYNGVCQYVGDTNITCTCQQGRVGEFCQEVDLCYSMPCQYSGVCQYVGDTNI
TCACLQGRVGEFCQEDDVCLPNPCQNNGSCINIELTHFSCSCEPGWTGDLCQIEDSCLSD
PCKNEGDCLLTNPGYLCVCPPGWLGIICDI
Download sequence
Identical sequences XP_011681391.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]