SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011718789.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011718789.1.29376
Domain Number 1 Region: 127-218
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.72e-22
Family Cold shock DNA-binding domain-like 0.0000038
Further Details:      
 
Domain Number 2 Region: 54-126
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 9.68e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011718789.1.29376
Sequence length 221
Comment PREDICTED: DNA-directed RNA polymerase II subunit RPB7 isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MLWEDVLPCEQGPGWRQGLGGKEEQGQAPARGSPCRLISSQRVAWSPSLFSPQISLEHEI
LLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVK
YKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTM
DEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
Download sequence
Identical sequences I7GM47
NP_001270787.1.63531 XP_011718789.1.29376 XP_014969241.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]