SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011731282.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011731282.1.29376
Domain Number 1 Region: 450-628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-51
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-19
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 148-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000029
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011731282.1.29376
Sequence length 630
Comment PREDICTED: E3 ubiquitin/ISG15 ligase TRIM25 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MAQLCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGAPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQAELAREPPADGWTPPARASAPSPGAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQSPVRDLLRRKCSQHNRLREFFCPEHGECICHICL
VEHKACSPASLSQASANLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LRQEYTEMKALLDASETTSTRKIKEEEKRVNTKFDTIYQILLKKKSEIQTLKEEIEQGLT
EGDEFEFLEKASKLRGISTKPVYIPEVELNRKLIKGIYHSTLDLKNELKQCIRQLQEPTP
SSGDPGEHDPASTQKSTRPAKKVSKEEKKSKKPPSVPASSSKLPTFGAPEQLVDLKQPGS
EAAAKATSSHPNSASLKAKVLETFLAKSRPELLEYYVKVILDYNTAHNKVALSESYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADRVHLM
YKFKVDFTEALYPAFWVFSAGATLSICSPK
Download sequence
Identical sequences A0A2K6E4E5 F6VU89 G7PUD8
ENSMMUP00000007639 XP_005583855.1.63531 XP_011731282.1.29376 XP_014974667.1.72884 9544.ENSMMUP00000007639 ENSMMUP00000007639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]