SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011814220.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011814220.1.43180
Domain Number 1 Region: 193-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 11-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 
Domain Number 3 Region: 97-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011814220.1.43180
Sequence length 360
Comment PREDICTED: poly(rC)-binding protein 4 isoform X3 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE
RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA
GTKIKEIRESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHA
VPFATPSVVPGLDPGTQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEG
AGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPGSAPADLPAPFSPPLTALPTAPP
GLLGTPYAISLSNFIGLKPVPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY
Download sequence
Identical sequences A0A2I3HF00 A0A2I3LFF7 A0A2K5JP02 A0A2K5LTF1 A0A2K5RRM1 A0A2K5TU00 A0A2K5XU86 A0A2K6B9J5 A0A2K6MYF5 A0A2K6PXY8 A0A2K6TNJ4 F6Z9R6
XP_011814220.1.43180 XP_011841653.1.47321 ENSMMUP00000029232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]