SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011935505.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011935505.1.92194
Domain Number 1 Region: 106-250
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.99e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 31-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000145
Family Glutathione S-transferase (GST), N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011935505.1.92194
Sequence length 253
Comment PREDICTED: chloride intracellular channel protein 4 isoform X1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD
GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKDMTGIWRYLTNAYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK
Download sequence
Identical sequences A0A096NDH5 A0A2K5IK67 A0A2K5M431 A0A2K5WP59 A0A2K6C2Z9 F6PP70
ENSPANP00000010921 ENSMMUP00000003241 9544.ENSMMUP00000003241 ENSMMUP00000003241 ENSMMUP00000003244 NP_001248536.1.72884 XP_005544468.1.63531 XP_011761185.1.29376 XP_011811032.1.43180 XP_011935505.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]