SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011966701.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011966701.1.54773
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-75
Family F-box associated region, FBA 0.00000187
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 1.27e-16
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011966701.1.54773
Sequence length 255
Comment PREDICTED: F-box only protein 44 isoform X1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MAVGNINELPENILLELFTHVPARQLLLRCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKVFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSKDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPAMIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences W5NSJ2
XP_004013770.1.66739 XP_011966699.1.54773 XP_011966700.1.54773 XP_011966701.1.54773 XP_012042718.1.66739 ENSOARP00000001132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]