SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012179628.1.98339 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012179628.1.98339
Domain Number 1 Region: 152-290
Classification Level Classification E-value
Superfamily ISP domain 1.44e-38
Family Rieske iron-sulfur protein (ISP) 0.00000307
Further Details:      
 
Domain Number 2 Region: 108-164
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.00000000000000371
Family ISP transmembrane anchor 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012179628.1.98339
Sequence length 292
Comment predicted protein [Fibroporia radiculosa]; AA=GCF_000313525.1; RF=representative genome; TAX=599839; STAX=599839; NAME=Fibroporia radiculosa; strain=TFFH 294; AL=Scaffold; RT=Major
Sequence
MAAIQLAKKAVTLPPTVRTLASGVPSASLINLSVREPAGHGHGHGHGVGPRSDVPPKWVG
GVSANSSVGLVSRNVVNGMEAVLAAGISLPPSTGIFQKRLIHSSVPAKDAPQVPDFSHYE
AKSESTNRGVAYFMIGSLGLLSATVAKSTVTEFLATMAASADVLAMAKVEIELASIPEGK
NAIIKWRGKPVFIRHRTQDEVQDARSTNWKSLRDPQSDEDRTKKPEWLVMLGVCTHLGCV
PIGEAGDYGGWFCPCHGSHYDISGRIRKGPAPSNLEVPQYDFDEANGLLVIG
Download sequence
Identical sequences J4GMU1
XP_012179628.1.98339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]