SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012240617.1.29386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012240617.1.29386
Domain Number 1 Region: 62-107
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0000000000000366
Family Cysteine-rich DNA binding domain, (DM domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012240617.1.29386
Sequence length 354
Comment PREDICTED: doublesex- and mab-3-related transcription factor A2 isoform X1 [Bombus impatiens]; AA=GCF_000188095.1; RF=representative genome; TAX=132113; STAX=132113; NAME=Bombus impatiens; AL=Scaffold; RT=Major
Sequence
MYREENEQNRTANLVPQQSNGANTFEHLEHSQDSMENGDEVVSTRVQTDASSSTNSTPRP
RAPRNCARCRNHRLKITLKSHKRYCKYRYCNCEKCKITADRQRVMAQQTKLRRQLAQDEV
KVRAAEEKLKKTKVWRSYETVDPLPFGAENDRVSSIPQPAISIEGSYDSSSGDSPVSSHG
SNGIHTGFGGVISIPPSRKLPPMHPHTATISHLPQSLTSESVEILLEHSTKLVELFQYPW
EAILLMYINLKYAGANPEEVVRRMVDASNEIRNMHFWKAVRMTQPSRSFRCTAACTAPTA
PPTGPPTYEGHVPYIGVVPPPNPVHYRPFLRPENAHIPGTRIPSSPDGPPEHST
Download sequence
Identical sequences XP_012164287.1.43243 XP_012164288.1.43243 XP_012240617.1.29386 XP_012240618.1.29386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]