SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012376516.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012376516.1.11602
Domain Number 1 Region: 3821-4059
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-87
Family Plakin repeat 0.0000000246
Further Details:      
 
Domain Number 2 Region: 3244-3482
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-86
Family Plakin repeat 0.0000000486
Further Details:      
 
Domain Number 3 Region: 2599-2825
Classification Level Classification E-value
Superfamily Plakin repeat 4.45e-82
Family Plakin repeat 0.000000126
Further Details:      
 
Domain Number 4 Region: 241-440
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-76
Family Calponin-homology domain, CH-domain 0.00000132
Further Details:      
 
Domain Number 5 Region: 2913-3152
Classification Level Classification E-value
Superfamily Plakin repeat 7.85e-75
Family Plakin repeat 0.000000413
Further Details:      
 
Domain Number 6 Region: 3579-3816
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-72
Family Plakin repeat 0.00000101
Further Details:      
 
Domain Number 7 Region: 4132-4173,4207-4401
Classification Level Classification E-value
Superfamily Plakin repeat 6.37e-70
Family Plakin repeat 0.000000309
Further Details:      
 
Domain Number 8 Region: 455-572
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-23
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 1155-1340
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-20
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 674-801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000705
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 11 Region: 4079-4127
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000183
Family Plakin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012376516.1.11602
Sequence length 4483
Comment PREDICTED: LOW QUALITY PROTEIN: plectin [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MVAGMLMPLDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGL
VRETFAWRHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVTPARPSPRVQAVQ
GPLGCPPKRGPPAEDPVREERRGYRRKEPEEGVSEPPVVPATTPGTLAQPSPEPTPATVP
QTTAAQYLRAVDEPAGGARHVPAQAPCGFLSRPRALPPQGSSLGWASGECGHPDPLCPQA
HRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVN
IRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLR
CDNFTTSWRDGRLFNAIIHRHRPTLIDMNKVYHQTNLENLDQAFSVAERDLGVTRLLDPE
DVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVQANELQLRWQEYRELLLLLLQWIRHHT
AAFEERKFPSSFEEIEILWCQFLKFKETELPAKEADKNRCKGIYQSLEGAVQAGQLKVPP
GYHPLDVEKEWGRLHVGILEREKQLRSEFERLERLQRVVSKLQMEAGLCEEQLNQADALL
QSDIRLLAAGKAPQRAGEVERDLDKADALIRVLFNDVQALKDGRHPQGEQMYRRWPLRAP
ARRIDARAGAEEKKIKEIQSTGDRCCGTTXPARPTVESFQAALQTQWSWMLQLCCCIEAH
XKENTAYFQFFADVREAEEQLQKLQETLRRKYTCDRSTTVTRLEDLLQDAQDEREQLNEY
KGHLLGLAKRAKAIVQLKPRNPAHPVRGPVPLLAVCDYKQMEVTVHKGDELQLVGAAQPA
HWKVLSSAGHEATVPSVCFLVPPPNQEAQEALARLEAQHQALVARWHELHVDLKSLLAWQ
GLSRDVQLIRSWSLVTFRTLKPEEQRHALRSLEQHYQAFLRDSQDAHGFGPEDRLQAERE
YSACSRHFQQLLQSLEQGEQEESRCQRCISELKDIRLRLEACETRTVHRLRLPLDKEPAR
ECAQRIAEQQKAQAEVEGLGKGVARLSVEAEEVLALPEPSPAVPTLRSELELTLGKLEQV
RSLSAIYLEKLKTISLVIRGTQGAEEVLRAHEEQLKAAQAVPATLPELEATKAALKKLRA
QAEAQQPVFDALQDELRAAQEVGERLQQRHGERDIEVERWRERVSQLLERWQAVLAQTDA
RQRELEQLGRQLRYYRESADPLGAWLQDARQRQEQIQAMPPADSRAVREQLRQEKALLEE
IERHGEKVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKAKVQSGAESVIQEYV
DLRTRYSELTTLTSQYFKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAE
AHAQAKAQAEREAQELQRRMQEEVVRREEAAVDAQQQKRSIQDELQHLRQSSEAEIQAKA
QQAEAAERSRLRIEEEIRVVRLQLEATERQRSGAEGELHALRARAEEAEAQKRQAQEEAE
RLRRQVQDESQRKRQAEADLALRVQAEAEAAREKQRALKALEELRLQAEEAERRLRQAEA
ERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVTQLREEAERRAQQQ
AEAERAREEAERELERWQLKANEALRLRLQAEEVAQHKSLAQAEAEKQKEAAEREARRRG
KAEEQAVRQRELAEQELERQRQLAEGTAQQRLVAEQELIRLRAETEQGEQQRQLLEEELT
RLQREAAAAAQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFR
ELAEEAARLRALAEEAKRQRQLAEEDAALQRAEAERVLAEKLAAIGEATRLKTEAEIALK
EKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASEVELDRQKGLVEDTL
RQRRQVEEEILALKASFEKATVGKAELELELGRIRSNAEDTLRSKEQAELEAQRQRQLAA
EEEQRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQ
VAQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDRLRGEAEAARRAADEAEAAR
EQAEREAAQSRRQVEEAERLKQAAEEQAQARGQAQAAAEKLRKDAEQEAVRRAQAEQAAL
RQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKGILDEELQRLKAEVT
EATRQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVA
EEAARLSVAAQEAARLRQLAEEDLAQQRSLAEKMLKEKMQAVQEATRLKAEAELLQQQKE
LAQEQARRLQEDKEQMAQQLAQETQGFQRTLETERQRQLEMSAEAERLKLRVAEMSRAQA
RAEEDAQRFRKQAEEIGEKLHLTELATQEKVTLVQTLEVQRQQSDQDAGRLREAIAELER
EKEKLKQEARLLQLKSQEMQTVQQEQLLQETQXLQQSFLSEKDSLLERERFIEQRRXQLE
QLFQDEVAKGAGELQENRRLRERLQQLEEEHRAVLAHTEEAAKALPNGHEVPDGPAAEAE
PQNEFDGLRRKGAGPAAAGGGHLGADELQRLEQGRTTVAELAQREDVRRYLQGRGSVAGL
LLKPSNEKLSVYEALRRQLLSPGTALILLEAQAASGFLLDPARNRRLTVNEAVKEGVVGP
ELHHKLLAAERAVTGYKDPYTGEQISLFQAMKKDLIVREHGVRLLEAQIATGGVIDPVHS
HRLPVEVAYQRGYFDEDMSRVLSDPSDDTKGFFDPNTHENLTYLQLLERCVTDPETGLRL
LPLTDKAARGGELVYTDSEARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFSAEQRRDL
LRQFRTGRITVEKIIKIVITVVEEHEQKGQLCFEGLRALVPAAELLDSGVIGQELYGQLQ
RGERSVREVAEVAAVRRALRGADVIAGVWLEEAGQKLSVYEALRRDLLAPEEALALLEAQ
AGTGHVIDPATSARLTVDEAVKASLVGPELHEKLLSAERAVTGYRDPYSGQSVSLFQALK
KGLLPREQGLRLLDAQLSTGGVVDPSKSHRVPLDVACARGFLDEETSRALSAPTDDAKTY
RDPGTQEPATYRQLQQRCRADPLTGLSLLPLSEQAARARREELYSAQQAREAFEKATVEA
PGGSFQGRTVSVWELISSEYFSEEQRQELLRQFRTGKVTVEKIIKILITIVEEVETRRRQ
QLSFSGLRAPVPASELLDAGVLSGAQFEQLRDGKTTVKELSEVGSVRTLLQGSGCVAGVY
LEASGEKVGVYEAMKRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPE
LHEKLLAAEKAVTGYRDPYSGSTISLFQAMRKSLVLREHGVRLLEAQIATGGVIDPVHSH
RLPVEVAYQRGYLDEDMSRVLSDPSDDTKGFFDPNTHENLTYLQLLERCVTDPETGLRLL
PLKAAEKPEVVETTHVYTEEETRRAFEETQIDIPGGSGGGSMSLWEVMQSDLIPEEQRAR
LLEDFRAGRVTKERMIIIIIEIIEKTEIVRQQNLASYDHVRRRLTAEELYEARVISLETY
NLIRAGAQTLREALEAEPTWCYLYGTGCVAGLYLPGSRQTLTVYQALKKGLVSAEAARLL
LEAQAATGFVLDPVKNERLTVDEAVRKGLVGPEMHDRLLWAERAVTGYRDPYTEQTISLF
QAMKKDLIPAEEALRLLDAQLATGGVIDPRLGVHLPLEVAYQRGHLNKDTHDRLSEPSEV
RGYVDPSTDEHLSYAQLLKRCRRDGPRSPFLLPLSDARRLTFRGLRKQITVEELVRSRVL
DEATALQLQEGLASVEEVTKNLQKFLEGTSCIAGVVVDATKERLSVYQAMKRGIIRPGTA
FELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLAAERAVTGYRDPYSGKLI
SLFQAMKKGLILKEHGIRLLEAQIATGGVIDPEESHRLPVEVAYQRGLFDEDMNEILSDP
SDDTKGFFDPNTEENLTYLQLMERCVTDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVI
VDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITTSTSDGVVKSMIIDRRSGRQY
DIDEAIAKSLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYSASPAPR
AQLSSWSDPTEETGPVAGILDTETLEKVSVTEAMHRNLVDNITGQRLLEAQACTGGIIDP
STGERFPVAEAVDRGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAG
QRFLEVQYLTGGLVEPDAPGRVPLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKI
SYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSAAGSRTGSRTGSRAGSRRG
SFDATGSGFSMTFSSSSYSSSGYGRRYASGAPASLGGPESAAA
Download sequence
Identical sequences XP_012376516.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]