SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012400741.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012400741.1.9362
Domain Number 1 Region: 242-392,625-711
Classification Level Classification E-value
Superfamily SET domain 2.18e-71
Family Histone lysine methyltransferases 0.0013
Further Details:      
 
Domain Number 2 Region: 152-223
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000131
Family Methyl-CpG-binding domain, MBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012400741.1.9362
Sequence length 714
Comment PREDICTED: histone-lysine N-methyltransferase SETDB2 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MEERNGDAKTFWRELEEDGKVDLIFEHVQNVLLSLKQKIKDGSATNQEYIQAMTLVNEAV
TTSNTFLLIKDEDITDRQNEQEDKTGVLPPTSHEESNSEDSLILTVEDIAVLTLENEVSD
YEDKIVSLRLFYQNHHCCDTCLPKTPFTSKVENPLMIPILSHFQRRHAKTNSNCAAFHVN
YKTPCGRSLRNFKEVHRYLLETDCSFLFLHHFSFNTYVQLNRNLLKKEVFVSDSDISHGT
ESVPVTFCNEIDNRRLPHFKYRRRTWPRAYYLNNFSGMFSNSCDCSKGCMDIEKCACLQL
TAKGYGESSAWSGVKPTPGYSYKRLQQPVPNGIFECSLLCKCDPRTCQNRVVQQGLQVRL
EVFKTEKKGWGVRCLDDIDKGTFVCTYSGRLLSRAGLEESSSVEGKEEEEEEDTITNDSG
SPAFSKKRRMEAAYSDPEIEFVQIEVGAIPGDTETEEYLIELSSDTNPSIEVENYEYDLR
IENQPAIRRPKTKTALLQNFRKKRGIITLEPGISSEEEDEAQLTEIQSISYINKKKRELS
CPVEYSKGKLCTMLVNHHCKEEILIENPCDRAASLCYGSEIKEYELQEQVLQEEETRERQ
NQEILCDEESLSETQADVSESLQKFQEDSVYLLDATKEGNVGRFLNHSCNPNLFVQNVFV
ETHDRNFPWVAFFTKRHVKAGTELTWDYGYEAGSIPEKEIPCQCGFHTCRKRIL
Download sequence
Identical sequences G3VYZ6
ENSSHAP00000008401 XP_012400741.1.9362 XP_012400742.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]