SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012646405.1.48125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012646405.1.48125
Domain Number 1 Region: 519-759
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-35
Family Ras GEF 0.0095
Further Details:      
 
Domain Number 2 Region: 139-257
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-25
Family SH2 domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012646405.1.48125
Sequence length 823
Comment breast cancer anti-estrogen resistance protein 3 isoform X1 [Microcebus murinus]; AA=GCF_000165445.2; RF=representative genome; TAX=30608; STAX=30608; NAME=Microcebus murinus; AL=Chromosome; RT=Major
Sequence
MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLAEHRSDAYQDVSIHGTLPRKKKGPPP
IRSSESFSHVGTLPHAKSPRQNSPLTQDVIQENPLQDWKTETFSFRDPHPMDPTLEYVKF
SKERHVMDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
SSPGNFVLTCQWKNLAQHFKIHRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRP
VSQQSGAIIFQPVNRTVPLRCLEERYGTSPGRAREGSLAEGRPDVTKRLSFTMGSAQARE
QNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPSQSPGVDASPC
PSSPVFRTGSEPTLSPAVVRRVSSDARPGEALRGSDSQLCPKPPPKPCKVPFLKAPSSPP
ARPNSEANYCELNPAFAAGCDQGARLPLCARGSRPELLTAKRHGAPGPRNSGINYSILDG
DDGARPWEPPAAQVDKEDEGTFVKPLLETVSSFRPNDFESKLLPAENKPLETAMLKRAKE
LFTSSGPKVIAQHMLSVDCKVARILEVSEETRRNMGVSSGLELITLPHGHQLRLDIIERH
NTMAIGIAVDVLGCTGTLEERAATLNRIIQVAVELKDSMGDLYSFSAVMKALEMPQITRL
EKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPSNISVPLLMPLVTLMERQAV
TFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRVNAERNLAGFQPDEEMSEIFKTEF
QMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL
Download sequence
Identical sequences ENSMICP00000009197 ENSMICP00000009197 XP_012646403.1.48125 XP_012646404.1.48125 XP_012646405.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]