SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012647838.1.55366 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012647838.1.55366
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily SRP19 1.44e-27
Family SRP19 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012647838.1.55366
Sequence length 139
Comment signal recognition particle subunit SRP19 [Babesia microti strain RI]; AA=GCF_000691945.2; RF=representative genome; TAX=1133968; STAX=5868; NAME=Babesia microti strain RI; strain=RI; AL=Chromosome; RT=Major
Sequence
MTEEDTCSWNIVYPCYIDKSKSCSGGRKVAAQYTVDNPTVDEIKLVCDRLELKCLIEREK
SHPKDWPPKGRVRVYLPSNTNTSNSQVITKLQLLRKVGSMIPMLKSRQELPSTSKTKPLI
AGVGEPTLSKSHKGKKGKK
Download sequence
Identical sequences I7J986
XP_012647838.1.55366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]