SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012719694.1.37407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012719694.1.37407
Domain Number 1 Region: 44-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-27
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 244-317
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000123
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 184-242
Classification Level Classification E-value
Superfamily LCCL domain 0.0000000000144
Family LCCL domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012719694.1.37407
Sequence length 415
Comment PREDICTED: discoidin, CUB and LCCL domain-containing protein 2 [Fundulus heteroclitus]; AA=GCF_000826765.1; RF=representative genome; TAX=8078; STAX=8078; NAME=Fundulus heteroclitus; AL=Scaffold; RT=Major
Sequence
MGRAVMVGRGPTGAAVLVLSLLILLTAEGCRGQKGDGCGPSVLGPSSGTLSSLGYPRTYP
DNSVCEWEITVPRGKRIHFRFALLDLQDGDCQVNYLRLYNGIGHERKEIVKYCGSGQKVD
ELIESSGNQATVQFMSGMHGTGRGVYLSYSTTEHPVEVTLLSLGSAHSCAVNVHSNSLSL
LCFFLQSSPLCVAAVHAGVVSNAAGGKIHVVSSKGILHYEGTLANNVTSTGGTLSNSLFT
FKTDGCYGRLGLESGGVADTQLNASSVLDSVNSTGHRSAWRQSGARLKKAGLPWAPAHSD
RQQWLQVDLKKEKRITGTSKNDICFVLTVTLRTFPKLFTPSGSTPPPGKTKHPPHLSETT
QTPEIRNTTMPPHAGQDVVLIAVLVPVAVMVLTALILTMAFACHWRNKKKRRSCC
Download sequence
Identical sequences XP_012719694.1.37407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]