SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012827058.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012827058.1.99540
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-50
Family Calponin-homology domain, CH-domain 0.000000185
Further Details:      
 
Domain Number 2 Region: 195-255
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.19e-21
Family EB1 dimerisation domain-like 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012827058.1.99540
Sequence length 269
Comment PREDICTED: microtubule-associated protein RP/EB family member 1 isoform X2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGSVYCQFMDMLFPGSVVLKK
VKFQAKLEHEYIQNFKVLQAGFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQESAPVPVLAAPVLNKPKKPLGSGNTAPQRTVPVQRTAVSNKPPAQGI
SKKPATVGNGDDESAELIQQINVLKITVEDLEKERDFYFGKLRNIELICQENEGESDPVL
QRIIEILYATDEGFVIPDEGAPPEDQEEY
Download sequence
Identical sequences Q6P848
ENSXETP00000055099 gi|38512258|gb|AAH61382| gi|45360879|ref|NP_989115| gi|60390185|sp|Q6P848| NP_989115.1.99540 XP_012827058.1.99540 XP_017945588.1.99540 ENSXETP00000055099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]