SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012880326.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012880326.1.60039
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.79e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 79-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000377
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012880326.1.60039
Sequence length 204
Comment PREDICTED: DNA-directed RNA polymerase III subunit RPC8 isoform X1 [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGQIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEATSSSEEPPKK
EAPYTLVGSISEPGLGLLSWWTSN
Download sequence
Identical sequences A0A1S3FUT6
XP_012880326.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]