SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012884105.1.60039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012884105.1.60039
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 6.41e-20
Family Nucleoplasmin-like core domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012884105.1.60039
Sequence length 193
Comment PREDICTED: nucleophosmin [Dipodomys ordii]; AA=GCF_000151885.1; RF=representative genome; TAX=10020; STAX=10020; NAME=Dipodomys ordii; AL=Scaffold; RT=Major
Sequence
MNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAE
SEDEEEEDVKLLSVSGKRSAPGGGSKVPQKKVKLAEEDEEEEDEDDDEEEDDDDDFDDEE
AEEKVPVKKSIRDTPAKNAQKSNQNGKDSKPATPRSKGQESFKKQEKTPKTPKGPSSVED
IKAKMQASIEKAL
Download sequence
Identical sequences A0A1S3G605
XP_012884105.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]