SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012909455.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012909455.1.14098
Domain Number 1 Region: 100-194
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-21
Family PDZ domain 0.0000313
Further Details:      
 
Domain Number 2 Region: 197-237
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000985
Family PDZ domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012909455.1.14098
Sequence length 239
Comment PREDICTED: syntenin-1-like [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPGNLEILSEASAPISQDGNLYPKLYPELSQYMGLS
LNEEQIRANMAVVPGAPVQGQLVARPSSMNYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTVHDRPFERTVTKHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNIC
Download sequence
Identical sequences M3YB94
ENSMPUP00000008601 ENSMPUP00000008601 XP_012909455.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]