SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013023613.1.62511 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013023613.1.62511
Domain Number 1 Region: 54-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 15-63
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000415
Family Glutathione S-transferase (GST), N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013023613.1.62511
Sequence length 206
Comment glutathione S-transferase Gst2 [Schizosaccharomyces cryophilus OY26]; AA=GCF_000004155.1; RF=representative genome; TAX=653667; STAX=866546; NAME=Schizosaccharomyces cryophilus OY26; strain=OY26; AL=Scaffold; RT=Major
Sequence
MVNFNFMLFSHKGGPNPWKNEQHLFYNPNGRVPTLIDHQNNDYAIWESDAILVYLADRYD
KERNISLPHDNPEYHHLIQYLFFQSSGQGVIWGQAGWFNFFHQEPVASAVTRYRNEIKRV
LCVLESILQDKDYLVAGKFTIADLSFVAWNDLLTAIFGPGRHEFKEELPQLDFEKEFPKT
HAWHKRLIERPAVVETIAERKQALQQ
Download sequence
Identical sequences S9VXU8
XP_013023613.1.62511 EPY51039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]