SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013031729.1.65836 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013031729.1.65836
Domain Number 1 Region: 56-102
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.72e-16
Family Cysteine-rich DNA binding domain, (DM domain) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013031729.1.65836
Sequence length 336
Comment PREDICTED: LOW QUALITY PROTEIN: doublesex- and mab-3-related transcription factor B1 [Anser cygnoides domesticus]; AA=GCF_000971095.1; RF=representative genome; TAX=381198; STAX=8845; NAME=Anser cygnoides domesticus; breed=Zhedong; AL=Scaffold; RT=Major
Sequence
MGSPAPPVPVATCWGGGGHALYIRPLWGSAGVCWAXWCGELVMEAREAIVAKAAVRTPKC
SRCRNHGFVVPVKGHAGQCRWKLCLCDKCSLITERQKIMAAQKALRQQVPDCPSRVAMGP
VPPGEGPRVAAGAAIAPEQSSHEGTKDSQPIGGSDKGMARRGLPPPPGGPPFWDYAHPAF
PPEYMVNSEYMERDPPKVYPGCSGVYPYHPFPMGFAINQPSCRGAPSPPGISLQKGFRHI
PSNYGPGNAASVSIPDGGGDLHQGYYAPLPQFIPPSFLPGVHYIPPPLSLNVLAETTKEA
HTTAADSQDSGVVCESSQPSSSPEEASGDQSVYSKQ
Download sequence
Identical sequences XP_013031729.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]