SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013248260.1.63183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013248260.1.63183
Domain Number 1 Region: 34-100
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.44e-22
Family eIF-2-alpha, C-terminal domain 0.00057
Further Details:      
 
Weak hits

Sequence:  XP_013248260.1.63183
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.00445
Family eIF2alpha middle domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013248260.1.63183
Sequence length 100
Comment eukaryotic translation initiation factor 2 alpha subunit, putative, partial [Eimeria acervulina]; AA=GCF_000499425.1; RF=representative genome; TAX=5801; STAX=5801; NAME=Eimeria acervulina; strain=Houghton; AL=Scaffold; RT=Major
Sequence
AAALDPDEVFGGLDVAEEVKQSLIQDIQLRLAPQALKLRARVDVWCFGRDGIEAVRAALQ
AGREVGDEKVEIIVKLIAPPQYVIVTSCFDRDTGLNKIQE
Download sequence
Identical sequences U6GRT7
XP_013248260.1.63183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]