SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013260285.1.5891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013260285.1.5891
Domain Number 1 Region: 185-300
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.7e-39
Family eIF-2-alpha, C-terminal domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 94-179
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 6.15e-28
Family eIF2alpha middle domain-like 0.0000798
Further Details:      
 
Domain Number 3 Region: 14-96
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.52e-16
Family Cold shock DNA-binding domain-like 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013260285.1.5891
Sequence length 313
Comment translation initiation factor 2 subunit 1 [Exophiala aquamarina CBS 119918]; AA=GCF_000709125.1; RF=representative genome; TAX=1182545; STAX=1033840; NAME=Exophiala aquamarina CBS 119918; strain=CBS 119918; AL=Scaffold; RT=Major
Sequence
MSDADSLTNCRFYEEKYPEIESFVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRI
RSIQKLIRIGRNEVVVVLRVDKEKGYIDLSKRRVSAEDIGRCEERYNKSKSVHSIMRHVA
EKTKTPILKLYEDIGWPLNRKYGHANDAFKLSITNPDVWNDVTFPNDVVKEEFQQYISKK
LTPHPTKVRADVEVTCFKYDGIDAVKEALRKAEAKNTPDTQVKVKLVSPPHYVLTSQCLD
KGHGIHLLEEAIKDIDETIKESGGQCVVKMAPKAVTEHDDAELQALMDKRAKENEEISGD
EDLSESDEGPEIA
Download sequence
Identical sequences A0A072PQB0
XP_013260285.1.5891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]