SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013405173.1.76062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013405173.1.76062
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 5.36e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0015
Further Details:      
 
Domain Number 2 Region: 79-149
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000137
Family Cold shock DNA-binding domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013405173.1.76062
Sequence length 149
Comment PREDICTED: DNA-directed RNA polymerase III subunit RPC8-like [Lingula anatina]; AA=GCF_001039355.1; RF=representative genome; TAX=7574; STAX=7574; NAME=Lingula anatina; AL=Scaffold; RT=Major
Sequence
MFVLADIKDTVRIPPWQFNVKLTDAVVEALNKKLANKVVHNVGLCIALWDITKLEDSYIL
PGDGSSHTVVHFRYVVFRPFNDEVVIGKIKSSSKEGVHVSLEFFDDILIPSDALQHPSRF
DEREQLWVWEYMVDEEKHDLYMDVGEEIR
Download sequence
Identical sequences A0A1S3J5Q9
XP_013405173.1.76062 XP_013405174.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]