SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013435440.1.101860 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_013435440.1.101860
Domain Number - Region: 29-86
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0811
Family Rap30/74 interaction domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013435440.1.101860
Sequence length 98
Comment XAP5 protein, putative, partial [Eimeria necatrix]; AA=GCF_000499385.1; RF=representative genome; TAX=51315; STAX=51315; NAME=Eimeria necatrix; strain=Houghton; AL=Scaffold; RT=Major
Sequence
HITFFELIKSKARGKSGPLFHFGAFDDVRVFSDIRKEKEDSHAGKVVDKKWFERNKHIFP
ASRWEVFNPAKIYDTYTIKGDERMWKGVADHSSFVPLP
Download sequence
Identical sequences U6MV43
XP_013435440.1.101860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]