SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013467034.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013467034.1.50012
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily TPR-like 3.37e-18
Family Tetratricopeptide repeat (TPR) 0.0036
Further Details:      
 
Weak hits

Sequence:  XP_013467034.1.50012
Domain Number - Region: 87-166
Classification Level Classification E-value
Superfamily PMT central region-like 0.0209
Family PMT central region-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013467034.1.50012
Sequence length 299
Comment RNA polymerase II-associated-like protein [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MYWVVLCSLNADYWGILDCGEITRNRAAALLQLDKLNKALDDAEMTIKLKPEWEKGHFRK
GCILEAMKRYDDALASFQIASQYNPQSQEVLKKIKKINQLVKDSKRAQEVENMRSNVDMA
KHLDTLKPEMSEKYGSEESWKDMFSFLVETMETAVKSWHETSSVDARVYFLHDKEKTQTD
KYPPIVNIDKAFESPETHSSCFPFLRQYAEESFSRAACLVAAKNIISYPQVWKGQGSRKW
KHAQNDGFFVQFESPSVRKLWFIPSSNEKGQILCRDPEILDVGAHEVVPRLFKEKTSQS
Download sequence
Identical sequences A0A072VGA8
Medtr1g041435.2 XP_013467034.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]