SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013948780.1.20613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013948780.1.20613
Domain Number 1 Region: 354-585
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.68e-47
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0000132
Further Details:      
 
Domain Number 2 Region: 605-761
Classification Level Classification E-value
Superfamily EF-hand 3.01e-20
Family Calmodulin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013948780.1.20613
Sequence length 772
Comment hypothetical protein TRIATDRAFT_260803 [Trichoderma atroviride IMI 206040]; AA=GCF_000171015.1; RF=representative genome; TAX=452589; STAX=63577; NAME=Trichoderma atroviride IMI 206040; strain=IMI 206040; AL=Contig; RT=Major
Sequence
MVQYVFTPWRDRQELLLVRDQFYGSEALTRADAAGGAASSSRIQGGRASGRRVEEAAYRD
AYAEDKREGEGLDRLNQGDAGRTTAAANDCQASSREQGDRDEQHKAVGRVSMWMQRGNCP
HMVESTALLMAAVLSDEAAAAGNAGASTYAVRAAYAAAFSRFVTGLLDGHQDKLRKQSMY
SIAKNIGLPATFVELRHQATHEQLPSLAKLRSAARKALVWIWDYYWKHLGEAEKAKDPCR
ELVLSYLRGDDEASRHRVMRQLRRWDLEYLQKTIAELQRTLPGNQVFLKCLKLSKDMAAM
TAEEANHPDPKVGGMPEQEQEQEQEPDRGSEPDTGWSQYSGAWRPKPIGVSRVGSSNNYA
YLVVDDKSKDAVIIDPANPPEVAPILKDAISSGQINLTAILAELNNEKLTIIGGKDCEGV
TKTPQHGETFQIGDISVRAVHTPCHTQDSICYFMEDSTGKAVFTGDTLFVSGCGKFFEGN
AAEMHEALNNRLGALPEDTVVYPGHEYTKSNVRFTISVSQTEPIKALQEFAENNQVTTGK
FTIGDEKKHNVFMRVNDPEIQKVTGETDPVSIMGKLREMKNNFKRPPKRKAGGPSTAPKP
RQSKLAKEHNVSAQEEGEIKEAFGLFAEPMDGEKNGVLPINDVKSALIALGIPPSSPAEL
HEFISILDPDNDGYATYEPFFAICALKFHAREDDTDAHHREELVEAFQLFTNGHDGPITL
AHLRRVAAVLKEDVDEELLKDMILEANGGVGVARGVELDEFDGVMRNAGVWR
Download sequence
Identical sequences G9NFA2
XP_013948780.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]