SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013957896.1.71794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013957896.1.71794
Domain Number 1 Region: 43-196
Classification Level Classification E-value
Superfamily EF-hand 2.04e-27
Family Calmodulin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013957896.1.71794
Sequence length 200
Comment hypothetical protein TRIVIDRAFT_73899 [Trichoderma virens Gv29-8]; AA=GCF_000170995.1; RF=representative genome; TAX=413071; STAX=29875; NAME=Trichoderma virens Gv29-8; strain=Gv29-8; AL=Scaffold; RT=Major
Sequence
MNSHTPRPFPGRSIAGGSNQHAQPRNPPAPQVSSNEDYGTIADEDREHIDEVFDLMDMKK
KGWLNSYEFKHSLAALGFDMPKPEYCRELENYGTVPPDWRDPHSCPVNRLLIYPDQFRLC
AAKLIARRDPREEAIKVFNMFDYDQDGIISVEDMRHLAQDIKEERTMTDEEIQTMIEHLD
HDGKGGVNLEEFIQMMEEAG
Download sequence
Identical sequences A0A0F9XQR1 A0A1T3C632 G9MP85
jgi|Triha1|494312|fgenesh1_pm.5_#_595 XP_013957896.1.71794 jgi|Trive1|73899|estExt_Genewise1Plus.C_60280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]