SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014040437.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014040437.1.97760
Domain Number 1 Region: 75-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-38
Family Motor proteins 0.00000463
Further Details:      
 
Domain Number 2 Region: 33-68
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000118
Family Myosin S1 fragment, N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014040437.1.97760
Sequence length 183
Comment PREDICTED: myosin-4-like, partial [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MSTDAEMQVYGKAAIYLRKSEKERMEAQAMPFDSKNSCYVTDKVELYLKGLVTARADGKC
TVTVTKPDGTKEEGKEFKDADIYEMNPPKYDKIEDMAMMTYLNEASVLYNLKERYAAWMI
YTYSGLFCATVNPYKWLPVYDEEVVNAYRGKKRGEAPPHIFSVSDNAFQFMMIDKENQSV
LIT
Download sequence
Identical sequences A0A1S3QKZ9
XP_014040437.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]