SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014121105.1.73095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014121105.1.73095
Domain Number 1 Region: 141-298
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.09e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 1-143
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.24e-63
Family DNA-binding protein LAG-1 (CSL) 0.0000126
Further Details:      
 
Domain Number 3 Region: 299-411
Classification Level Classification E-value
Superfamily E set domains 1.4e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014121105.1.73095
Sequence length 465
Comment PREDICTED: recombining binding protein suppressor of hairless isoform X2 [Zonotrichia albicollis]; AA=GCF_000385455.1; RF=representative genome; TAX=44394; STAX=44394; NAME=Zonotrichia albicollis; AL=Scaffold; RT=Major
Sequence
MRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCTEQ
ESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGV
FLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQ
QWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLD
ADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDK
AEYTFYEGMGPVHAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMY
RCAESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCS
AAGAILRANSSLMASSETNTNSEGSYTSVSTNPTNVTSSTATVVS
Download sequence
Identical sequences XP_008928571.1.96775 XP_009069501.1.14518 XP_012429112.1.42559 XP_014117867.1.90289 XP_014121105.1.73095 XP_014121106.1.73095 XP_014746973.1.99236 XP_014746974.1.99236 XP_014746975.1.99236 XP_017664833.1.3805 XP_017923568.1.51550 XP_018781019.1.15306 XP_018781024.1.15306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]