SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014392843.1.60319 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014392843.1.60319
Domain Number 1 Region: 239-277
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000222
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014392843.1.60319
Sequence length 279
Comment PREDICTED: vasodilator-stimulated phosphoprotein, partial [Myotis brandtii]; AA=GCF_000412655.1; RF=representative genome; TAX=109478; STAX=109478; NAME=Myotis brandtii; AL=Scaffold; RT=Major
Sequence
LITGFYSRFPGGGPPAPPPPPPPQPQAAPPAWSVQNGPAPEEAEFQKRQPEHLERRVSNA
GAPPAPPAGGPPPPPGPPPPPGPPPPSGLPPSGVSAVGHGAGGGPPPPPPLPTAAGPSGG
GTGAPGLAAAIAGAKLRKVSKEEASGGPAAPKAESSRSTGGGLMEEMNAMLARRRKATLV
GEKPPKDESANEEPEARVPAQSEPVRRPWEKNSTTLPRMKSSSSVTTSEAHPATPSSGDE
SDLERVKQEFLEEVRKELQKVKEEIIEAFVQELRKRGSP
Download sequence
Identical sequences XP_014392843.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]