SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014435243.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014435243.1.96668
Domain Number 1 Region: 60-165
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.4e-37
Family Nucleoplasmin-like core domain 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014435243.1.96668
Sequence length 239
Comment PREDICTED: nucleoplasmin-2 isoform X3 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MQEIRLNQLMLPFGLNSMENSTPVSVLWERLCSECCFLPSLLAPMALNSSTNSDSKSEKP
VSLIWGCELSREKQTYTFQIPQKWKYEQQLALRTICLGERAKDEFNVVEIVPSEDSKDTT
PVPLATLKPSVLPMASMVGVELTPPVTFRLRAGSGPVYITGQHVTLIPDLSWDEEEEEEE
EEVAEEESSQEESPPKPIKHAAPNKRGNIAKQHPFGRRRLSQQGKRNGQREKVGSKEID
Download sequence
Identical sequences XP_014435243.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]