SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014653005.1.5094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014653005.1.5094
Domain Number 1 Region: 178-603
Classification Level Classification E-value
Superfamily Sema domain 1.96e-98
Family Sema domain 0.00029
Further Details:      
 
Domain Number 2 Region: 1503-1628,1825-1976
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-37
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 1056-1145
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000127
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 4 Region: 964-1059
Classification Level Classification E-value
Superfamily E set domains 0.000000000000122
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 606-658
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000733
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1144-1188,1226-1279
Classification Level Classification E-value
Superfamily E set domains 0.00000153
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014653005.1.5094
Sequence length 2044
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-B3 [Ceratotherium simum simum]; AA=GCF_000283155.1; RF=representative genome; TAX=73337; STAX=9807; NAME=Ceratotherium simum simum; AL=Scaffold; RT=Major
Sequence
MASTDFPSLTSWSMSMSSPISLGSCPLPFVCRLPTPPFSPSPHHHLCSLASPSSCLPLSV
SLSLSLPALFVPLFAPLHPLSLSVLAFCLSVLLSLPFYVCLSSRCFSLSGALSPPPLFCP
DSARQVWGGQAPAHQASCSSALPQAPAMDPWPPFNPHLLLVLLLLLLCPPPPPTQAHRFS
APNTTLNRLALAPGRGTLYVGAVNRLFQLSPALQLEAVAVTGPVFDSPDCVPFRDPAECP
QARLTDNANQLLLVSSRSQELVACGQVRQGVCEKRRLEDVAEVLYQAEDPGDGQFVAANA
LGVATVGLVVPTPGRDLLLVARGLAGKLSGGVPPLSVRQLAGPQPFSSEGLGRLVVGDLS
DYNNSYVGAFADARSAYFVFRRRGARKQAEYHSYVARVCLGDANLYSYVEVPLTCRGQGL
VHAAFLTPGTLLGAFAAGPRGAQAALCAFPLAELDRTMEQARRLCYTAGGRGPSGAEEAT
VEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGLQPLEAEPLLQLGQPISAITALHADGH
TIAFLGDTQGRLHKVFLNGSQGQVYHSQQVGPPGSAISPDLLVDSSGSHLYILTAQQVDR
VSVADCPQSSNCTSCLQARDPLCGWCVLQGRCTRKGQCGRAAQPNQWLWSYEKDSRCLHV
QSLLPAHHPRQEQGQVTLSVPRLPTLTMDEYFHCAFGDYDSLAHVEGPHVACVTPPQDQL
PLNPPGTDHITLPLALMFEDVAVAATNFSFYDCSAVQALEVAAPCRACVSSLWRCHWCPQ
SSNCVHGEHCPEGERTIYSAQEVDVQERGPGACPQVEGLAGPVLVPVGWESRLALRVWNL
QHFRGLPASYHCWLELPGELRRLPASLEEMAGDTSLIYCQAQQFHPSMAQRELPVPIYVT
RGKGQRLDNARPLHVTLYDCAVGHPDCSHCQAANRSLGCLWCSHGQPTCRYGPLCPPGAV
ELLCPTPSIDTIEPLTGPPEGGLALTILGSNLGRDFADVRDAVSVAGQPCSPDPSLYRTS
ARIVCVTSPAPNGTVGPIQVAIKSRPPGISTQHFTYQDPVLLSLSPQWGPQAGGTQLTIH
GQHLQTGGNISAFVGGQPCPIQEPVCPEAIVCHTMPQASPGEAVVRVVFGHAQRTLLTSP
FRYTADPQLLVAEPSVSFRGGGRLIRVRGTGLNVVRRPLLSVWLETVVEVQAAGAQPRDL
MPRRSCGAPAAAPHACIQLEAGLLQCSTVCSVNSSSLLLCWSPAVPDGARPQRVFFALDN
VHVDFASANGGQDFLYQPNPRLAPLSREGPTRPYRLKPGNVLDVEGEGLNLGISKEEVRV
HIGDGECLVKTLTLTHLYCEPPPQAPQPTNGSSTLPQFVVQMGNVRLALGPVQYEAEPVL
SAFPMEAQVGLGVGAAVLTAAVLLLTLMYRHKSKQALRDYQKVLVQLENLEIGVGDQCRK
EFTDLMTEMTDLSSDLEATGIPFLDYHTYAERVFFPGHGGCPLQPVLEGPGEESRRAPMR
HGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLVLHSKLEYLTDIMRTLL
GDLAAHYVHKNPKLMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLLRAIQYQVDK
GPVDAVTGKAKRTLNNSRLLREDVEFRPLTLMVLVGPGAGGAPGSSAAQRVPARVLDTDT
ITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTL
QHYKVPDGATVGLIPQVHNGGAISQSLAQSCPSRENIPMPEDSEEGGVRLWHLVKATEEP
EGAKVRRSSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPVPIAV
KYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFWVNTLKNPRLIFDVRVSDNVDAILAV
IAQTFIDSCTVSEHKVGRDSPVNKLLYAREIPRYKQMVERYYYDIRQSSAASYQEMNSAL
AELSGNYASAPHCLEALQELYKHIHRYYDQIISALEEDPVGQKMQLACRLQQIAALVENK
VTDL
Download sequence
Identical sequences XP_014653005.1.5094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]