SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014791115.1.24776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014791115.1.24776
Domain Number 1 Region: 90-199
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.22e-41
Family FAD-dependent thiol oxidase 0.00000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014791115.1.24776
Sequence length 200
Comment PREDICTED: FAD-linked sulfhydryl oxidase ALR-like [Octopus bimaculoides]; AA=GCF_001194135.1; RF=representative genome; TAX=37653; STAX=37653; NAME=Octopus bimaculoides; AL=Scaffold; RT=Major
Sequence
MSASNLPKSEVDSPIPSNSSNSHTSGSEQDPSQKPASKLETSTSAKVSFDLDVKKDEKPS
SKLCRACTDFKTWMKAQPAITKVEKKPVECPLDKNELGSNTWSLLHTMAAYYPDKPTPQQ
QQDMHSFINIFAKFYPCEYCAEHLREDLKTNAPDTSSRHNLSQWFCHTHNRVNLLLGKPQ
FDCSKVDERWKDGWKDGSCD
Download sequence
Identical sequences A0A0L8I3Y5
XP_014791109.1.24776 XP_014791110.1.24776 XP_014791111.1.24776 XP_014791112.1.24776 XP_014791114.1.24776 XP_014791115.1.24776 XP_014791116.1.24776 Ocbimv22036409m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]