SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014853563.1.96476 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014853563.1.96476
Domain Number 1 Region: 149-422
Classification Level Classification E-value
Superfamily EndoU-like 2.35e-86
Family Eukaryotic EndoU ribonuclease 0.0000136
Further Details:      
 
Domain Number 2 Region: 61-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000222
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 20-58
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000471
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 4 Region: 104-141
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000589
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014853563.1.96476
Sequence length 424
Comment PREDICTED: poly(U)-specific endoribonuclease isoform X1 [Poecilia mexicana]; AA=GCF_001443325.1; RF=representative genome; TAX=48701; STAX=48701; NAME=Poecilia mexicana; AL=Scaffold; RT=Major
Sequence
MKVAAILLLCMALFHQGHSNSCQGRCGYGIDTSYSCQCNTACERYNDCCSDYYTLCKEAA
LSCNGRCGESYNAQNPCHCNSLCPQYNNCCSDYSTLCNAVVGPTSCNGRCGESYNAQNPC
HCNSQCSQYNNCCSDYSDYCSTGDSGATITDAEIKSLSETLFALDTNKASASQLILDPQA
LVADSQTSSQSDLSSRPLYKFVDENALFSRPTYAALLNLFDNYKRITGQAESFTSQQLTE
QETFLKETMLNTELGRELFAFLYTKGVYKSEAEFIEDLKNMWFGLYSRYNGAMDSSGFEH
IFAGEIKGGKVSGFHNWIRFYLLEKRGELNYYSHSFNGPWSNYPDVLGLQFHWDGYYKQV
GSAVIGCSPEFDLALYSLCYIARPGKYCYLSLGGKQFIIQTYTWDNSSYGNGKKYIGSAY
PVSM
Download sequence
Identical sequences XP_014853562.1.96476 XP_014853563.1.96476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]