SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014963620.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014963620.1.54773
Domain Number 1 Region: 26-122
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 5.36e-30
Family DNA-binding protein LAG-1 (CSL) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014963620.1.54773
Sequence length 135
Comment PREDICTED: recombining binding protein suppressor of hairless-like protein [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MEPEAEDLGQKRRTPEALLPSVYSSADEHCSQGDFPPREGYVRYGSLVQLVCTVTGITLP
PMIIRKVAKQCALLDVDEPISQLHKCAFQFPGGPPGGGGTYLCLATEKVVQFQVRSRDSW
HQASQKIRTAKNSRI
Download sequence
Identical sequences XP_014955386.1.66739 XP_014963620.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]