SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015331243.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015331243.1.76553
Domain Number 1 Region: 135-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000896
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015331243.1.76553
Sequence length 412
Comment PREDICTED: zinc finger protein 821 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MSRRKQTNPNKVHWDQVFAGLEEQARQAMMKTDFPGDLGSQRQAIQQLRDQDSSSSDSEG
DEEETTQDEVSSHTSEEDGGVVKVEKELENAEQPVGGKKVVEHEVTENLHSDPLLGLCQC
PLCQLDCGSREQLIAHVYQHTAAVVSAKSYMCPVCGRALSSPGSLGRHLLIHSEDQRSNC
AVCGARFTSHATFNSEKLPEVLNVESLPPAHSEGPSSAEGKDIAFTPPVYPAGILLVCNN
CAAYRKLLEAQTPSVRKWALRRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRD
REAKRLQRMQETDEQRARRLQRDREAMRLKRANETPEKRQARLIREREAKRLKRRLEKMD
MMLRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH
Download sequence
Identical sequences Q32KS7
ENSBTAP00000032245 9913.ENSBTAP00000032245 ENSBTAP00000032245 NP_001033241.1.59421 NP_001033241.1.76553 XP_005218695.1.76553 XP_005218696.1.76553 XP_005896552.1.15283 XP_014333961.1.15283 XP_014333962.1.15283 XP_014333963.1.15283 XP_015331243.1.76553 XP_015331244.1.76553 XP_019835446.1.53367 XP_019835447.1.53367 XP_019835448.1.53367 XP_019835449.1.53367 XP_019835450.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]